« Back
Home /
TMEM195 Antibody - N-terminal region

TMEM195 Antibody - N-terminal region

Item no.	ARP44469_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Food Safety Vitamines Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP
Citations	Scherer,S.W., (2003) Science 300 (5620), 767-772
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TMEM195
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	51kDa
Species Tested	Human
Gene symbol	AGMO
Gene Fullname	Alkylglycerol monooxygenase
Protein size	445
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.
Nucleotide accession_num	NM_001004320
Protein accession_num	NP_001004320
Protein name	Alkylglycerol monooxygenase
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM195
Homology	Dog: 100%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 92%; Rat: 85%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 11/27/2025

Express Delivery: Save 10 days

Compare

Add to wishlist

Get an offer