Comparison

BTN2A1 Antibody - N-terminal region

Item no. ARP46817_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host Rabbit
Sequence SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH
Citations Malcherek,G., (2007) J. Immunol. 179 (6), 3804-3811
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias BTF1,BT2.1,BTN2.1,DJ3E1.1,BK14H9.1
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
60 kDa
Species Tested
Human
Gene symbol
BTN2A1
Gene Fullname
Butyrophilin, subfamily 2, member A1
Protein size
527
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
UBC;
Description of target
The specific functin of this protein remains unknown.This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism.
Nucleotide accession_num
NM_007049
Protein accession_num
NP_008980
Protein name
Butyrophilin subfamily 2 member A1
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BTN2A1
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 82%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 91%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close