Comparison

ACE2 Antibody - middle region

Item no. ARP53751_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, IHC
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host Rabbit
Sequence FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP
Citations ACE2 Therapy Using Adeno-associated Viral Vector Inhibits Liver Fibrosis in Mice. Mol. Ther. 23, 1434-43 (2015). 25997428
Plasma and tissue angiotensin-converting enzyme 2 activity and plasma equilibrium concentrations of angiotensin peptides in dogs with heart disease. J Vet Intern Med. 33, 1571-1584 (2019). 31254308
Tropism of SARS-CoV-2, SARS-CoV and influenza virus in canine tissue explants. J Infect Dis. (2021). 33395484
Haga,S., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7809-7814
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias ACEH
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
89kDa
Species Tested
Human, Rat
Gene symbol
ACE2
Gene Fullname
Angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Protein size
805
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
ACE2; AGT; CALM1; NTS; GHRL;
Description of target
ACE2 belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63. The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This protein catalyzes the cleavage of angiotensin I into angiotensin 1-9. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Nucleotide accession_num
NM_021804
Protein accession_num
NP_068576
Protein name
Angiotensin-converting enzyme 2
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACE2
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 86%; Rat: 93%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close