« Back
Home /
Rnf216 Antibody - N-terminal region

Rnf216 Antibody - N-terminal region

Item no.	ARP57824_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Diabetes Glucose Homeostasis Antibodies By Cell Type Hematology Myeloma Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Western Blot Primary Antibodies Neurodegeneration Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	UIP,UIP83,C86502,TRIAD3,Ubce7i,AI647468,AU019462,Ubce7ip1,2810055G22Rik,F830018F18Rik
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Apoptosis, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Research Areas/Disease Related, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	93kDa
Species Tested	Mouse
Gene symbol	RNF216
Gene Fullname	ring finger protein 216
Protein size	853
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Ube2l3;
Description of target	Rnf216 acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. It promotes degradation of TRAF3, TLR4 and TLR9. It contributes to the regulation of antiviral responses. It down-regulates activation of NF-kappa-B, IRF3 activation and IFNB production and promotes TNF and RIP mediated apoptosis.
Protein name	E3 ubiquitin-protein ligase RNF216
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Rnf216
Homology	Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 1/29/2026

Compare

Add to wishlist

Get an offer

Request delivery time