« Back
Home /
TNFRSF4 Antibody - middle region

TNFRSF4 Antibody - middle region

Item no.	ARP59086_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Diabetes Aging & Neurological Disorders Antibodies By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Western Blot Autophagy Primary Antibodies By Organ Colorectal Cancer Testicular & Prostate Cancer Calcium Binding Protein Markers Neurodegeneration Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	GKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQ
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	OX40,ACT35,CD134,IMD16,TXGP1L
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Products/Polyclonal Antibodies/Cell Cycle Proteins, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	27kDa
Species Tested	Human
Gene symbol	TNFRSF4
Gene Fullname	Tumor necrosis factor receptor superfamily, member 4
Protein size	277
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	TRAF4; TRAF5; TRAF3; TRAF2; TRAF1; TNFRSF9; SIVA1; TNFSF4;
Description of target	The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.
Nucleotide accession_num	NM_003327
Protein accession_num	NP_003318
Protein name	Tumor necrosis factor receptor superfamily member 4
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human TNFRSF4
Homology	Human: 100%; Pig: 86%
Concentration	0.5 mg/ml
Sample Type Confirmation	TNFRSF4 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 2/12/2026

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer