« Back
Home /
BSND Antibody - middle region

BSND Antibody - middle region

Item no.	ARP59579_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Metabolism Diabetes Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Specific against	Human (Homo sapiens), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	PGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDD
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	BART,DFNB73
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Ion Channel, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Tissue Specific & Cell Marker, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	35 kDa
Species Tested	Human
Gene symbol	BSND
Gene Fullname	barttin CLCNK type accessory beta subunit
Protein size	320
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	FATE1; APP;
Description of target	This gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness.
Nucleotide accession_num	NM_057176.2.
Protein accession_num	NP_476517
Protein name	barttin
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human BSND
Homology	Human: 100%; Pig: 77%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer