« Back
Home /
AGTR2 Antibody - N-terminal region

AGTR2 Antibody - N-terminal region

Item no.	ARP59983_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Aging & Neurological Disorders Antibodies Western Blot Cardiovascular Research Heart Failure Primary Antibodies By Organ Uterine, Ovarian & Cervical Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	LHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVT
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	AT2,ATGR2,MRX88
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Research Areas/GPCR, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	41kDa
Species Tested	Human, Mouse
Gene symbol	AGTR2
Gene Fullname	Angiotensin II receptor, type 2
Protein size	363
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	ERBB2IP; TIMP3; SNTA1; ZBTB16; MTUS1; PIK3CB; ERBB3; GNAI3; GNAI2; ACE; AGT; AGTRAP;
Description of target	The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation.
Nucleotide accession_num	NM_000686
Protein accession_num	NP_000677
Protein name	Type-2 angiotensin II receptor
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human AGTR2
Homology	Cow: 86%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 79%; Rat: 93%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer