Comparison

SRPK1 Antibody - C-terminal region

Item no. ARP61556_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host Rabbit
Sequence SSQNGDSSTSQETDSCTPITSEVSDTMVCQSSSTVGQSFSEQHISQLQES
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias SFRSK1
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Cancer, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Research Areas/Stem Cells, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
72kDa
Species Tested
Human
Gene symbol
SRPK1
Gene Fullname
SRSF protein kinase 1
Protein size
655
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
SUMO2; UBC; DROSHA; WWOX; HECW2; ASXL1; DAW1; CSAG1; OR6B3; C18orf25; FAM76B; SREK1; RIMS4; NOL4L; SRSF12; C16orf78; ARHGAP12; C11orf52; YTHDC1; PRPF38A; ZNF514; LCE3D; MAP1LC3A; MRPL43; KIAA1841; SETD3; NSRP1; AMMECR1L; VANGL1; C11orf63; OCEL1; NKAP; C1o
Description of target
This gene encodes a serine/arginine protein kinase specific for the SR (serine/arginine-rich domain) family of splicing factors. The protein localizes to the nucleus and the cytoplasm. It is thought to play a role in regulation of both constitutive and alternative splicing by regulating intracellular localization of splicing factors. Alternative splicing of this gene results in multiple transcript variants.
Nucleotide accession_num
NM_003137
Protein accession_num
NP_003128
Protein name
SRSF protein kinase 1
Clonality
Polyclonal
Purification
Affinity Purified
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 86%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close