Comparison

Pkn2 Antibody - C-terminal region

Item no. ARP61895_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Yeast (Saccharomyces cerevisiae), Cow (Bos taurus)
Host Rabbit
Sequence LRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGRE
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias PR,Prk,Stk,PRK2,Stk7,Prkcl2,AI507382,6030436C20Rik
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Cancer, Root Catalog/Products/Polyclonal Antibodies/Protein Kinases, Root Catalog/Products/Polyclonal Antibodies/Cell Adhesion, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
111kDa
Species Tested
Mouse
Gene symbol
PKN2
Gene Fullname
protein kinase N2
Protein size
983
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
Pkn2 is a PKC-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. It plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migration, cell adhesion, tumor cell invasion and transcription activation signaling processes. Pkn2 phosphorylates CTTN in hyaluronan-induced astrocytes and hence decreases CTTN ability to associate with filamentous actin, phosphorylates HDAC5, therefore lead to impair HDAC5 import. It is a direct RhoA target required for the regulation of the maturation of primordial junctions into apical junction formation in bronchial epithelial cells and is required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. It stimulates FYN kinase activity that is required for establishment of skin cell-cell adhesion during keratinocytes differentiation, regulates epithelial bladder cells speed and direction of movement during cell migration and tumor cell invasion, inhibits Akt pro-survival-induced kinase activity. It mediates Rho protein-induced transcriptional activation via the c-fos serum response factor (SRF).
Nucleotide accession_num
NM_178654
Protein accession_num
NP_848769
Protein name
Serine/threonine-protein kinase N2
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Pkn2
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 77%; Zebrafish: 93%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close