« Back
Home /
CFHR1 Antibody - N-terminal region

CFHR1 Antibody - N-terminal region

Item no.	ARP62261_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Food Safety Proteins Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	NHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	H36,CFHL,FHR1,HFL1,HFL2,CFHL1,FHR-1,H36-1,H36-2,CFHL1P,CFHR1P
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Disease Related, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	36kDa
Species Tested	Human
Gene symbol	CFHR1
Gene Fullname	Complement factor H-related 1
Protein size	330
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	PRDX4; LBP; APOA1; CFH;
Description of target	This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome.
Nucleotide accession_num	NM_002113
Protein accession_num	NP_002104
Protein name	Complement factor H-related protein 1
Clonality	Polyclonal
Purification	Affinity Purified
Homology	Human: 100%; Rat: 77%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 11/27/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer