« Back
Home /
IL13RA1 Antibody - N-terminal region

IL13RA1 Antibody - N-terminal region

Item no.	ARP63415_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Neural Transcription Factors Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Cell Biology Cell Culture Cytokines Adenocarcinoma Western Blot Primary Antibodies By Organ Colorectal Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	YFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVE
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	NR4,CT19,CD213A1,IL-13Ra
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signaling Intermediate, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	46kDa
Species Tested	Human
Gene symbol	IL13RA1
Gene Fullname	interleukin 13 receptor subunit alpha 1
Protein size	427
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; IL2RG; TMEM39B; ELAVL1; TRAF3IP1; DLG4; TYK2; IL4R; IL13;
Description of target	The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 receptor, and may also be a component of IL4 receptors. This protein has been shown to bind tyrosine kinase TYK2, and thus may mediate the signaling processes that lead to the activation of JAK1, STAT3 and STAT6 induced by IL13 and IL4.
Protein accession_num	NP_001551
Protein name	interleukin-13 receptor subunit alpha-1
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Human I13R1
Homology	Cow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer