« Back
Home /
DNAJC7 Antibody - C-terminal region

DNAJC7 Antibody - C-terminal region

Item no.	ARP65551_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Neural Lineage Markers Aging & Neurological Disorders Antibodies Western Blot Primary Antibodies Neurodegeneration Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	KTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMH
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DJ11,DJC7,TPR2,TTC2
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Cell Biology, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	56kDa
Species Tested	Human
Gene symbol	DNAJC7
Gene Fullname	DnaJ (Hsp40) homolog, subfamily C, member 7
Protein size	494
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	TP53; SPRTN; CDC37; BAG4; HSPA1L; UBC; TPM1; NRD1; HSPA8; HSPA1A; HSP90AA1; vif; NOS2; SMAD9; SMAD2; ITGA4; TP53BP1; LMAN1; PTGES3; PGR; NR3C2; HSPA4; NR3C1; AR; CUL3; FBXO25; DISC1; ATG2A; MKNK1; UBE4B; DNAJC7; SMURF1; RAD9A; HUS1; RAD1; NF1;
Description of target	This gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by two N-terminal tetratricopeptide repeat domains and a C-terminal DNAJ domain. This protein binds the chaperone proteins heat shock proteins 70 and 90 in an ATP-dependent manner and may function as a co-chaperone. Pseudogenes of this gene are found on chromosomes 1 and 6. Alternate splicing results in multiple transcript variants.
Nucleotide accession_num	NM_003315
Protein accession_num	NP_003306
Protein name	DnaJ homolog subfamily C member 7
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human DNAJC7
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 2/12/2026

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer