« Back
Home /
QSOX2 Antibody - middle region

QSOX2 Antibody - middle region

Item no.	ARP67254_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Antibodies Western Blot Primary Antibodies By Organ Nervous System Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine)
Host	Rabbit
Sequence	VVKPLRAFFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWREFDKSKLY
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SOXN,QSCN6L1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Apoptosis, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	77kDa
Species Tested	Human
Gene symbol	QSOX2
Protein size	698
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	SUMO1; SUMO2; PAN2; MMS19; SLC25A3; ILF3; UBC;
Description of target	QSOX2 is a member of the sulfhydryl oxidase/quiescin-6 (Q6) family that regulates the sensitization of neuroblastoma cells for IFN-gamma-induced cell death.
Nucleotide accession_num	NM_181701
Protein accession_num	NP_859052
Protein name	Sulfhydryl oxidase 2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of Human QSOX2
Homology	Dog: 77%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Rat: 85%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 2/26/2026

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer