« Back
Home /
RHOBTB3 Antibody - N-terminal region

RHOBTB3 Antibody - N-terminal region

Item no.	ARP74182_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Molecular Targets for Neuroscience Antibodies Cell Biology Cytoskeleton Western Blot Primary Antibodies small GTPases Rho Subfamily
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	ALGNEGDTFHQDNRPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFT
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	KIAA0878
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	67kDa
Species Tested	Human
Gene symbol	RHOBTB3
Gene Fullname	Rho related BTB domain containing 3
Protein size	611
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	RBPMS; BHLHE40; UBXN11; RBX1; CCNA1; CUL3; CCNE1; CCNB1; UBC; PLIN3; RAB9A; RHOBTB2; RHOBTB3; Lrrc41; HTR7; HGS;
Description of target	RHOBTB3 is a member of the evolutionarily conserved RHOBTB subfamily of Rho GTPases. For background information on RHOBTBs, see RHOBTB1 (MIM 607351).[supplied by OMIM, Apr 2004]
Protein accession_num	NP_055714
Protein name	rho-related BTB domain-containing protein 3
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHBT3
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/30/2025

Compare

Add to wishlist

Get an offer

Request delivery time