Comparison

DDX19B Antibody - N-terminal region

Item no. ARP77092_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens)
Host Rabbit
Sequence WALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKED
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias DBP5,RNAh,DDX19
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Mitochondria, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
53 kDa
Species Tested
Human
Gene symbol
DDX19B
Gene Fullname
DEAD-box helicase 19B
Protein size
479
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Nucleotide accession_num
NM_001014449.2
Protein accession_num
NP_001014449.1
Protein name
ATP-dependent RNA helicase DDX19B
Clonality
Polyclonal
Purification
Affinity purified
Immunogen
The immunogen is a synthetic peptide directed towards the N region of human DDX19B
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close