« Back
Home /
INA Antibody - middle region

INA Antibody - middle region

Item no.	ARP77932_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Targets for Rodent Neurosciences Antibodies By Cell Type Carcinoma Immunohistochemistry Western Blot ELISA Primary Antibodies Oligodendrocyte Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	DLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAE
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	NEF5,NF-66,TXBP-1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	55 kDa
Species Tested	Human
Gene symbol	INA
Gene Fullname	internexin neuronal intermediate filament protein, alpha
Protein size	499
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons.
Nucleotide accession_num	NM_032727.3
Protein accession_num	NP_116116.1
Protein name	alpha-internexin
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human INA
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer