« Back
Home /
RUBCNL Antibody - middle region

RUBCNL Antibody - middle region

Item no.	ARP79396_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Antibodies Cell Biology Cell Status Western Blot Autophagy Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	SQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAV
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PACER,C13orf18,KIAA0226L
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	35 kDa
Species Tested	Human
Gene symbol	RUBCNL
Gene Fullname	RUN and cysteine rich domain containing beclin 1 interacting protein like
Protein size	321
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	This gene encodes a cysteine-rich protein that contains a putative zinc-RING and/or ribbon domain. The encoded protein is related to Run domain Beclin-1-interacting and cysteine-rich domain-containing protein, which plays a role in endocytic trafficking and autophagy. In cervical cancer cell lines, this gene is expressed at low levels and may function as a tumor suppressor. Promoter hypermethylation of this gene is observed in cervical cancer cell lines and tissue derived from human patients.
Nucleotide accession_num	NM_001286761.1
Protein accession_num	NP_001273690.1
Protein name	protein RUBCNL-like
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human C13ORF18
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer