« Back
Home /
XRCC2 Antibody - middle region

XRCC2 Antibody - middle region

Item no.	ARP80946_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding Neural Adhesion Molecules Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Myeloma Melanoma Sarcoma Adenocarcinoma Western Blot Endocrine Regulation of Lipid Metabolism Primary Antibodies By Organ Testicular & Prostate Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	VNDYRLVLFATTQTIMQKASSSSEEPSHASRRLCDVDIDYRPYLCKAWQQ
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FANCU,POF17,SPGF50
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Cell Cycle Proteins, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/DNA Damage & Repair, Root Catalog/Research Areas/Apoptosis, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	30 kDa
Species Tested	Human
Gene symbol	XRCC2
Gene Fullname	X-ray repair complementing defective repair in Chinese hamster cells 2
Protein size	280
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.
Nucleotide accession_num	NM_005431.1
Protein accession_num	NP_005422.1
Protein name	DNA repair protein XRCC2
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human XRCC2
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer