« Back
Home /
TMED10 Antibody - middle region

TMED10 Antibody - middle region

Item no.	ARP83323_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Metabolism Cholesterol & Lipid Metabolism Aging & Neurological Disorders Antibodies Western Blot Enzymes Prostaglandin Synthases Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	AKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLY
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	p23,TMP21,p24d1,S31I125,Tmp-21-I,S31III125,P24(DELTA)
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Membrane & Traffic, Root Catalog/Research Areas/Disease Related, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	24 kDa
Species Tested	Human
Gene symbol	TMED10
Gene Fullname	transmembrane p24 trafficking protein 10
Protein size	219
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cisternae and is involved in vesicular protein trafficking. The protein is also a member of a heteromeric secretase complex and regulates the complex's gamma-secretase activity without affecting its epsilon-secretase activity. Mutations in this gene have been associated with early-onset familial Alzheimer's disease. This gene has a pseudogene on chromosome 8.
Nucleotide accession_num	NM_006827.5
Protein accession_num	NP_006818.3
Protein name	transmembrane emp24 domain-containing protein 10
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle terminal region of human TMED10
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/30/2025

Compare

Add to wishlist

Get an offer

Request delivery time