« Back
Home /
TUBB4 Antibody - N-terminal region

TUBB4 Antibody - N-terminal region

Item no.	ARP83630_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Neural Lineage Markers Antibodies Cell Biology Cytoskeleton Western Blot Primary Antibodies Mikrotubules Neurodegeneration Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	CGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVP
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DYT4,TUBB4,beta-5
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Disease Related, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	50 kDa
Species Tested	Human
Gene symbol	TUBB4
Gene Fullname	tubulin beta 4A class IVa
Protein size	444
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	This gene encodes a member of the beta tubulin family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene cause hypomyelinating leukodystrophy-6 and autosomal dominant torsion dystonia-4. Alternate splicing results in multiple transcript variants encoding different isoforms. A pseudogene of this gene is found on chromosome X.
Nucleotide accession_num	NM_001289123.1
Protein accession_num	NP_001276052.1
Protein name	tubulin beta-4A chain
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human TUBB4
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/13/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer