« Back
Home /
BCLAF1 Antibody - middle region

BCLAF1 Antibody - middle region

Item no.	ARP84858_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Antibodies By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Cell Biology Cell Status Apoptosis Western Blot Autophagy Primary Antibodies By Organ Colorectal Cancer Testicular & Prostate Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	YKDDSKHKREQDHSRSSSSSASPSSPSSREEKESKKEREEEFKTHHEMKE
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	BTF,bK211L9.1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Apoptosis, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	101 kDa
Species Tested	Human
Gene symbol	BCLAF1
Gene Fullname	BCL2 associated transcription factor 1
Protein size	920
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	This gene encodes a transcriptional repressor that interacts with several members of the BCL2 family of proteins. Overexpression of this protein induces apoptosis, which can be suppressed by co-expression of BCL2 proteins. The protein localizes to dot-like structures throughout the nucleus, and redistributes to a zone near the nuclear envelope in cells undergoing apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Nucleotide accession_num	NM_001077440.1
Protein accession_num	NP_001070908.1
Protein name	bcl-2-associated transcription factor 1
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human BCLAF1
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 11/13/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer