Comparison

EEF1E1 Antibody - N-terminal region

Item no. ARP85516_P050
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens)
Host Rabbit
Sequence ELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQA
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias P18,AIMP3
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signaling Intermediate, Root Catalog/Research Areas/DNA Damage & Repair, Root Catalog/Research Areas/Apoptosis, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
20 kDa
Species Tested
Human
Gene symbol
EEF1E1
Gene Fullname
eukaryotic translation elongation factor 1 epsilon 1
Protein size
174
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2.
Nucleotide accession_num
NM_001135650.1
Protein accession_num
NP_001129122.1
Protein name
eukaryotic translation elongation factor 1 epsilon-1
Clonality
Polyclonal
Purification
Affinity purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EEF1E1
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close