« Back
Home /
ACAP2 Antibody - middle region

ACAP2 Antibody - middle region

Item no.	ARP85695_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Antibodies Cell Biology Cytoskeleton Western Blot Primary Antibodies small GTPases Arf Subfamily
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	AYREKGDESEKLDKKSSPSTGSLDSGNESKEKLLKGESALQRVQCIPGNA
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CENTB2,CNT-B2
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	85 kDa
Species Tested	Human
Gene symbol	ACAP2
Gene Fullname	ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
Protein size	778
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6).
Nucleotide accession_num	NM_012287.5
Protein accession_num	NP_036419.3
Protein name	arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ACAP2
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/30/2025

Compare

Add to wishlist

Get an offer

Request delivery time