Comparison

HDAC2 Antibody - middle region

Item no. ARP88977_P050
Manufacturer AVIVA Systems Biology
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Mouse (Murine, Mus musculus)
Host Rabbit
Sequence EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRA
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias YAF1,Yy1b,Yy1bp,mRPD3,D10Wsu179,D10Wsu179e
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Products/Polyclonal Antibodies/Cell Cycle Proteins, Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
53 kDa
Species Tested
Mouse
Gene symbol
HDAC2
Gene Fullname
histone deacetylase 2
Protein size
488
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.
Nucleotide accession_num
NM_008229.2
Protein accession_num
NP_032255.2
Protein name
histone deacetylase 2
Clonality
Polyclonal
Purification
Affinity purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse HDAC2
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Delivery expected until 10/30/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close