« Back
Home /
NOXO1 Antibody - N-terminal region

NOXO1 Antibody - N-terminal region

Item no.	ARP90245_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Molecular Targets for Neuroscience Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	VQMDRLQTFAFSVCWSDNSDTFVRRSWDEFRQLQKTLKKTFPVEAGLLRR
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	hslt,Snx28,P41NOX,P41NOXA,P41NOXB,P41NOXC,2310034C04Rik
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	26 kDa
Gene symbol	NOXO1
Gene Fullname	NADPH oxidase organizer 1
Protein size	239
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Constitutively potentiates the superoxide-generating activity of NOX1 and NOX3 and is required for the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity. Isoform 3 is more potent than isoform 1 in activating NOX3. Together with NOXA1, may also substitute to NCF1/p47phox and NCF2/p67phox in supporting the phagocyte NOX2/gp91phox superoxide-generating activity.
Nucleotide accession_num	NM_027988.4
Protein accession_num	NP_082264.2
Protein name	NADPH oxidase organizer 1
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of mouse NOXO1
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 1/8/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer