« Back
Home /
TUFM Antibody - middle region

TUFM Antibody - middle region

Item no.	ARP90950_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Neuroscience Aging & Neurological Disorders Antibodies Cell Biology Cell Status Western Blot Autophagy Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	DHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYS
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	EFTU,C76308,C76389,EF-TuMT,2300002G02Rik
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/Mitochondria, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	49 kDa
Gene symbol	TUFM
Gene Fullname	Tu translation elongation factor, mitochondrial
Protein size	452
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. Plays also a role in the regulation of autophagy and innate immunity. Recruits ATG5-ATG12 and NLRX1 at mitochondria and serves as a checkpoint of the RIG-I/DDX58-MAVS pathway. In turn, inhibits RLR-mediated type I interferon while promoting autophagy.
Nucleotide accession_num	NM_001163713.1
Protein accession_num	NP_001157185.1
Protein name	elongation factor Tu, mitochondrial
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of mouse TUFM
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer