« Back
Home /
PDE1B Antibody - middle region

PDE1B Antibody - middle region

Item no.	ARP91339_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Diabetes Neural Transcription Factors Molecular Targets for Neuroscience Aging & Neurological Disorders Neural Signaling Neural Epigenetics Neural Adhesion Molecules Antibodies Western Blot Primary Antibodies By Organ Bladder Cancer Calcium Binding Protein Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	PTVFLMSFLEALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLS
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Pde1b1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Immunology, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	58 kDa
Species Tested	Mouse
Gene symbol	PDE1B
Gene Fullname	phosphodiesterase 1B, Ca2+-calmodulin dependent
Protein size	535
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a preference for cGMP as a substrate (By similarity).
Nucleotide accession_num	NM_008800.2
Protein accession_num	NP_032826.1
Protein name	calcium/calmodulin-dependent 3' , 5' -cyclic nucleotide phosphodiesterase 1B
Clonality	Polyclonal
Purification	Affinity purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of mouse PDE1B
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 10/30/2025

Compare

Add to wishlist

Get an offer

Request delivery time