« Back
Home /
TNFRSF11B Antibody - N-terminal region

TNFRSF11B Antibody - N-terminal region

Item no.	AVARP00033_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Glucose Homeostasis Aging & Neurological Disorders Neural Signaling Antibodies By Cell Type Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Western Blot Primary Antibodies By Organ Lymphatic System Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	LDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTV
Citations	Cross,S.S., et al., (2006) Int. J. Cancer 118 (8), 1901-1908
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	OPG,TR1,OCIF,PDB5
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Cardiovascular, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Receptors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	46kDa
Species Tested	Human
Gene symbol	TNFRSF11B
Gene Fullname	Tumor necrosis factor receptor superfamily, member 11b
Protein size	401
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	TNFSF13; TNFSF10; TNFSF11; VWF; VTN; THBS1; FN1;
Description of target	TNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand (TNFSF11/OPGL), both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined.
Nucleotide accession_num	NM_002546
Protein accession_num	NP_002537
Protein name	Tumor necrosis factor receptor superfamily member 11B
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human TNFRSF11B
Homology	Dog: 78%; Horse: 78%; Human: 100%; Mouse: 85%; Pig: 78%; Rabbit: 78%; Rat: 78%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 1/29/2026

Express Delivery: Save 10 days

Compare

Add to wishlist

Get an offer