Comparison

WDR3 Antibody - middle region

Item no. AVARP02043_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Cow (Bos taurus)
Host Rabbit
Sequence VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT
Citations Nousiainen,M., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (14), 5391-5396
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias DIP2,UTP12
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Apoptosis, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
106kDa
Species Tested
Human
Gene symbol
WDR3
Gene Fullname
WD repeat domain 3
Protein size
943
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
UBC; RPA3; RPA2; RPA1; EED; rev; SOX2; PNO1; BYSL; SIRT7; SUMO2; USP43; USP36; PDE10A;
Description of target
WDR3 is a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.This gene encodes a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
Nucleotide accession_num
NM_006784
Protein accession_num
NP_006775
Protein name
WD repeat-containing protein 3
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human WDR3
Homology
Cow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 80%; Zebrafish: 78%
Concentration
0.5 mg/ml
Sample Type Confirmation

WDR3 is supported by BioGPS gene expression data to be expressed in HeLa

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close