Comparison

Anti-SARS-CoV-2 NSP3 Antibody European Partner

Item no. BOS-A33999-Dylight594
Manufacturer Boster
Amount 100 ug
Quantity options 100 ug/vial 10 ug 100 ug/vial 100 ug/vial 100 ug/vial 100 ug 100 ug 100 ug 100 ug/vial 100 ug/vial 100 ug/vial 100 ug/vial 100 ug
Category
Type Primary Antibody
Format Lyophilized
Applications ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag DyLight 594
Sensitivity >5000 cells
Citations 1. Benedetti F, et al. J Transl Med, 2020 Aug 31.
2. Douangamath A, et al. Nat Commun, 2020 Oct 7.
3. Krafcikova P, et al. Nat Commun, 2020 Jul 24.
4. Rosas-Lemus M, et al. Sci Signal, 2020 Sep 29.
5. Vuong W, et al. Nat Commun, 2020 Aug 27.
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Replicase polyprotein 1ab,pp1ab,ORF1ab polyprotein,nsp3,Non-structural protein 3,PL2-PRO,Papain-like proteinase,PL-PRO
Available
Manufacturer - Category
Primary Antibodies
Storage Conditions
Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Observed Molecular weight
140 kDa, 130 kDa, 110 kDa
Calculated Molecular weight
16693 MW
Clonality
Polyclonal
Application Details
ELISA, 0.001-0.1μg/ml, Human
Gene Name
rep
Gene Full Name
Non-structural protein 3
Background
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.
Immunogen
HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Purification
Immunogen affinity purified.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Manufacturer - Research Category
Protein Phosphorylation, Ser/Thr Kinases, Signal Transduction
Protein Function
Inhibitor of PPP1CA. Has over 1000-fold higher inhibitory activity when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.
Subcellular Localization
Cytoplasm.
Description
Boster Bio Anti-SARS-CoV-2 NSP3 Antibody catalog # A33999. Tested in ELISA applications. This antibody reacts with Human.
Tissue Specificity
Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?