« Back
Home /
Anti-SUR2B Antibody

Anti-SUR2B Antibody

Item no.	73-399
Manufacturer	Antibodies Incorporated
Amount	5 mL
Category	Antibodies Immunohistochemistry Immunocytochemistry Primary Antibodies Immunoblot
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IHC, ICC
Clone	N323B/20
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG2b
Conjugate/Tag	Unconjugated
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
Shipping Condition	Cool pack
Available
Manufacturer - Type	Primary Antibody
Manufacturer - Targets	SUR2B
Country of Origin	United States
Shipping Temperature	Shipped on ice packs
Storage Conditions	Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight	175 kDa (and smaller fragments likely due to proteolytic cleavage)
Manufacturer - Research Area	Ion Channels and Modulators, Ion Channel Modulators
Expiration	24 months from date of receipt
Immunogen	Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli
Immunogen Species	Rat
Description	Our Anti-SUR2B mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N323B/20. It detects human, mouse, and rat SUR2B, and is TC supernatant. It is great for use in IHC, ICC, WB.
Target Description	Sulfonylurea receptor 2B (SUR2A), or ATP binding cassette transporter subfamily C member 9 is encoded by the gene ABCC9 and is a member of the ABC transporter super family. Differential splicing of the ABCC9 gene produces 2 isoforms, SUR2A and SUR2B. SUR2b forms smooth muscle KATP channels with KCNJ8(Kir6.1) and is is involved in regulation and activation. It is also expressed in brain. Diseases associated with this gene include Cantu Syndrome and Dilated Cardiomyopathy 1O.
Clonality	Monoclonal
Manufacturer - Specificity	Does not cross-react with SUR1
Concentration	Lot dependent
Form	TC Supernatant
Buffer	Supernatant is provided in cell culture medium with 0.1% sodium azide as anti-microbial
Production Notes	Supernatant is harvested from hybridoma cells grown under standard cell culture conditions
Quality Control	Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
Quality Control: Application	ICC
Usage Statement	These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement	We produce our SUR2B mouse monoclonal primary antibody from hybridoma clone N323B/20. It is great in IHC, ICC, WB and is TC supernatant.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 5 mL

available

Delivery expected until 9/11/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer