Comparison

Ataxin-1, 11NQ

Item no. 73-117
Manufacturer Antibodies Incorporated
Amount 5 mL
Category
Type Antibody Monoclonal
Applications IP, IHC, IB
Clone N76/8
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Mouse
Isotype IgG2b
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Available
Manufacturer - Category
Tags, Rare Disease Markers, CounterACT, and More!
Description
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1
(also known as spinocerebellar ataxia type 1 protein homolog accession number P54254)
Rat: 100% identity (34/34 amino acids identical)
Human: 88% identity (30/34 amino acids identical)
Expected Banding Pattern
85 kDa
Validation
T|Br-IB|Br-IHC|KO

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 mL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close