Comparison

p90 RSK Antibody (Phospho-Thr359+Ser363)

Item no. OAAF07418
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, IF, IHC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence RREIKPPFKPAVAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFS
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias 90 kDa ribosomal protein S6 kinase 1;dJ590P13.1 (ribosomal protein S6 kinase,90kD,polypeptide 1);HU-1;MAP kinase-activated protein kinase 1a;MAPK-activated protein kinase 1a;MAPKAP kinase 1a;MAPKAPK1;MAPKAPK-1a;MAPKAPK1A;p90Rsk;p90-RSK 1;p90RSK1;p90S6K;ribosomal protein S6 kinase alpha-1;ribosomal protein S6 kinase,90kDa,polypeptide 1;ribosomal S6 kinase 1;RSK;RSK1;RSK-1;S6K-alpha 1.
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
82 kDa
Manufacturer - Application Additional Information
WB: 1:500~1000IHC: 1:50~100ELISA: 1:1000
Gene symbol
RPS6KA1
Gene Fullname
ribosomal protein S6 kinase A1
Product format
LiquidPBS (without Mg2+ and Ca2+) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol
Reconstitution and storage
-20°C
Description of target
Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of the transcription factors CREB1, ETV1/ER81 and NR4A1/NUR77, regulates translation through RPS6 and EIF4B phosphorylation, and mediates cellular proliferation, survival, and differentiation by modulating mTOR signaling and repressing pro-apoptotic function of BAD and DAPK1. In fibroblast, is required for EGF-stimulated phosphorylation of CREB1, which results in the subsequent transcriptional activation of several immediate-early genes. In response to mitogenic stimulation (EGF and PMA), phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors and the cofactor CREBBP. Upon insulin-derived signal, acts indirectly on the transcription regulation of several genes by phosphorylating GSK3B at 'Ser-9' and inhibiting its activity. Phosphorylates RPS6 in response to serum or EGF via an mTOR-independent mechanism and promotes translation initiation by facilitating assembly of the pre-initiation complex. In response to insulin, phosphorylates EIF4B, enhancing EIF4B affinity for the EIF3 complex and stimulating cap-dependent translation. Is involved in the mTOR nutrient-sensing pathway by directly phosphorylating TSC2 at 'Ser-1798', which potently inhibits TSC2 ability to suppress mTOR signaling, and mediates phosphorylation of RPTOR, which regulates mTORC1 activity and may promote rapamycin-sensitive signaling independently of the PI3K/AKT pathway. Mediates cell survival by phosphorylating the pro-apoptotic proteins BAD and DAPK1 and suppressing their pro-apoptotic function. Promotes the survival of hepatic stellate cells by phosphorylating CEBPB in response to the hepatotoxin carbon tetrachloride (CCl4). Mediates induction of hepatocyte prolifration by TGFA through phosphorylation of CEBPB (By similarity). Is involved in cell cycle regulation by phosphorylating the CDK inhibitor CDKN1B, which promotes CDKN1B association with 14-3-3 proteins and prevents its translocation to the nucleus and inhibition of G1 progression. Phosphorylates EPHA2 at 'Ser-897', the RPS6KA-EPHA2 signaling pathway controls cell migration (PubMed:26158630).
Protein name
Ribosomal protein S6 kinase alpha-1
Clonality
Polyclonal
Purification
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from human p90 RSK around the phosphorylation site of Thr359 and Ser363.
Manufacturer - Specificity
p90 RSK (Phospho-Thr359+Ser363) Antibody detects endogenous levels of p90 RSK only when phosphorylated at Thr359 and Ser363.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close