Comparison

DAPP1 Antibody (Phospho-Tyr139)

Item no. OAAF07542
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Applications WB, IF, IHC, ICC, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Rabbit
Sequence FVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTE
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias b lymphocyte adapter protein Bam32;BAM32;B-cell adapter molecule of 32 kDa;dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide;hDAPP1.
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Applications
Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
32 kDa
Manufacturer - Application Additional Information
WB: 1:500~1:1000
IF: 1:100~1:500
ELISA: 1:5000
Gene symbol
DAPP1
Gene Fullname
dual adaptor of phosphotyrosine and 3-phosphoinositides 1
Reconstitution and storage
-20°C
Description of target
May act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.
Protein name
Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
Clonality
Polyclonal
Purification
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from human DAPP1 around the phosphorylation site of Tyr139.
Manufacturer - Specificity
DAPP1 (Phospho-Tyr139) Antibody detects endogenous levels of DAPP1 only when phosphorylated at Tyr139.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close