« Back
Home /
NIPA Antibody (Phospho-Ser354)

NIPA Antibody (Phospho-Ser354)

Item no.	OAAF07639
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Melanoma Adenocarcinoma Western Blot ELISA Immunofluorescence Immunocytochemistry Primary Antibodies Astrocytoma Immunostaining Immunochemistry
Type	Antibody Polyclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Monkey (Cynomolgus, Simian)
Host	Rabbit
Sequence	ESPRRMMTRSQDATFSPGSEQAEKSPGPIVSRTRSWDSSSPVDRPEPEAA
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	hematopoietic stem/progenitor cell protein 216;HSPC216;NIPA;nuclear interacting partner of anaplastic lymphoma kinase (ALK);nuclear-interacting partner of ALK;Nuclear-interacting partner of anaplastic lymphoma kinase;Zinc finger C3HC-type protein 1.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	55 kDa
Manufacturer - Application Additional Information	WB: 1:500~1:1000 ELISA: 1:40000
Gene symbol	ZC3HC1
Gene Fullname	zinc finger C3HC-type containing 1
Reconstitution and storage	-20°C
Description of target	Essential component of a SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry. May have an antiapoptotic role in NPM-ALK-mediated signaling events.
Protein name	Nuclear-interacting partner of ALK
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human NIPA around the phosphorylation site of Ser354.
Manufacturer - Specificity	NIPA (Phospho-Ser354) Antibody detects endogenous levels of NIPA only when phosphorylated at Ser354.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAF07639-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/8/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer