« Back
Home /
TIRAP Antibody (Phospho-Tyr86)

TIRAP Antibody (Phospho-Tyr86)

Item no.	OAAF07852
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Metabolism Diabetes Molecular Targets for Neuroscience Neural Signaling Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Lymphoma Myeloma Melanoma Sarcoma Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IF, IHC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Sequence	SQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQ
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	adapter protein wyatt;adaptor protein Wyatt;BACTS1;Mal;MyD88 adapter-like protein;MyD88-2;toll/interleukin-1 receptor domain-containing adapter protein;toll-interleukin 1 receptor (TIR) domain containing adaptor protein;Toll-like receptor adaptor protein;wyatt.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Phospho Specific, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	23 kDa
Manufacturer - Application Additional Information	IHC 1:50~100 ELISA 1:10000
Gene symbol	TIRAP
Gene Fullname	TIR domain containing adaptor protein
Product format	Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Reconstitution and storage	-20°C
Description of target	Adapter involved in TLR2 and TLR4 signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response. Positively regulates the production of TNF-alpha and interleukin-6.
Protein name	Toll/interleukin-1 receptor domain-containing adapter protein
Clonality	Polyclonal
Purification	The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from human TIRAP around the phosphorylation site of Tyr86.
Manufacturer - Specificity	TIRAP (Phospho-Tyr86) Antibody detects endogenous levels of TIRAP only when phosphorylated at Tyr86.
Concentration	1 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAF07852-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer