« Back
Home /
CACYBP Antibody

CACYBP Antibody

Item no.	OAAF08073
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Targets for Rodent Neurosciences Neural Adhesion Molecules Antibodies By Cell Type Blastoma Carcinoma Hematology Leukemia Adenocarcinoma Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Type	Antibody Polyclonal
Applications	WB, IF, IHC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	KECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	calcyclin-binding protein;GIG5;growth-inhibiting gene 5 protein;hCacyBP;PNAS-107;S100A6-binding protein;S100A6BP;Siah-interacting protein;Siah-interacting protein (SIP);SIP.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	26 kDa
Manufacturer - Application Additional Information	WB: 1:500~1:1000 ELISA: 1:10000
Gene symbol	CACYBP
Gene Fullname	calcyclin binding protein
Reconstitution and storage	-20°C
Description of target	May be involved in calcium-dependent ubiquitination and subsequent proteasomal degradation of target proteins. Probably serves as a molecular bridge in ubiquitin E3 complexes. Participates in the ubiquitin-mediated degradation of beta-catenin (CTNNB1).
Protein name	Calcyclin-binding protein
Clonality	Polyclonal
Purification	The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from the C-terminal region of human CACYBP.
Manufacturer - Specificity	CACYBP Antibody detects endogenous levels of CACYBP protein.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAF08073-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/8/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer