Comparison

PVRL3 Antibody

Item no. OAAF08108
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Rabbit
Sequence WPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQKVIYISDPPT
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CD113;CDW113;nectin 3;Nectin cell adhesion molecule 3;nectin-3;poliovirus receptor-related 3;poliovirus receptor-related protein 3;PPR3;PRR3;PVRL3;PVRR3.
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Molecular Weight
61 kDa
Manufacturer - Application Additional Information
WB: 1:500~1:1000
ELISA: 1:10000
Gene symbol
NECTIN3
Gene Fullname
nectin cell adhesion molecule 3
Reconstitution and storage
-20°C
Description of target
Plays a role in cell-cell adhesion through heterophilic trans-interactions with nectin-like proteins or nectins, such as trans-interaction with NECTIN2 at Sertoli-spermatid junctions. Trans-interaction with PVR induces activation of CDC42 and RAC small G proteins through common signaling molecules such as SRC and RAP1. Also involved in the formation of cell-cell junctions, including adherens junctions and synapses. Induces endocytosis-mediated down-regulation of PVR from the cell surface, resulting in reduction of cell movement and proliferation. Plays a role in the morphology of the ciliary body.
Protein name
Nectin-3
Clonality
Polyclonal
Purification
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Immunogen
The antiserum was produced against synthesized peptide derived from the Internal region of human PVRL3.
Manufacturer - Specificity
PVRL3 Antibody detects endogenous levels of PVRL3 protein.
Formulation
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration
1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close