« Back
Home /
CD300LG Antibody

CD300LG Antibody

Item no.	OAAF08124
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Antibodies Cell Biology Cell Movement Cell Adhesion Immunohistochemistry Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining
Type	Antibody Polyclonal
Applications	WB, IF, IHC, ELISA
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	EELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSL
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CD300 antigen-like family member G;CLM9;CLM-9;CMRF35-like molecule 9;NEPMUCIN;TREM4;TREM-4;triggering receptor expressed on myeloid cells 4.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Molecular Weight	36 kda
Manufacturer - Application Additional Information	WB: 1:500~1:1000 ELISA: 1:10000
Gene symbol	CD300LG
Gene Fullname	CD300 molecule like family member g
Reconstitution and storage	-20°C
Description of target	Receptor which may mediate L-selectin-dependent lymphocyte rollings. Binds SELL in a calcium dependent manner. Binds lymphocyte (By similarity).
Protein name	CMRF35-like molecule 9
Clonality	Polyclonal
Purification	The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Immunogen	The antiserum was produced against synthesized peptide derived from the Internal region of human CD300LG.
Manufacturer - Specificity	CD300LG Antibody detects endogenous levels of CD300LG protein.
Formulation	Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Concentration	1mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAF08124-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer