« Back
Home /
SNAPC4 Antibody

SNAPC4 Antibody

Item no.	OAAL00307
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Antibodies Immunohistochemistry Western Blot ELISA Immunofluorescence Cardiovascular Research Heart Failure Hypertension Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IF, IHC, ELISA
Clone	1D1
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKDKVTGVGPPAN
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	proximal sequence element-binding transcription factor subunit alpha;PSE-binding factor subunit alpha;PTF subunit alpha;PTFalpha;SNAP190;SNAPc 190 kDa subunit;SNAPc subunit 4;snRNA-activating protein complex 190 kDa subunit;snRNA-activating protein complex subunit 4.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunofluorescence\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	SNAPC4
Gene Fullname	small nuclear RNA activating complex polypeptide 4
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Nucleotide accession_num	NM_003086
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_003077
Protein name	Homo sapiens small nuclear RNA activating complex polypeptide 4 (SNAPC4), mRNA\|snRNA-activating protein complex subunit 4 [Homo sapiens]
Clonality	Monoclonal
Immunogen	SNAPC4 (NP_003077, 53 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00307-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer