« Back
Home /
SRF Antibody

SRF Antibody

Item no.	OAAL00313
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Neural Lineage Markers Neural Transcription Factors Neural Signaling Antibodies Immunohistochemistry Western Blot ELISA Primary Antibodies Immunostaining Neuronal Cell Markers
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	1C8
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHSTKSE
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	c-fos serum response element-binding transcription factor;MCM1;minichromosome maintenance 1 homolog;serum response factor.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	SRF
Gene Fullname	serum response factor
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). [provided by RefSeq
Nucleotide accession_num	BC048211
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH48211
Protein name	Homo sapiens serum response factor (c-fos serum response element-binding transcription factor), mRNA (cDNA clone MGC:52246 IMAGE:5808348), complete cds\|Serum response factor (c-fos serum response element-binding transcription factor) [Homo sapiens]
Clonality	Monoclonal
Immunogen	SRF (AAH48211, 406 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00313-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/11/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer