« Back
Home /
PKMYT1 Antibody

PKMYT1 Antibody

Item no.	OAAL00435
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Aging & Neurological Disorders Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Myeloma Melanoma Sarcoma Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	2A3
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	PASWLQPLGPPATPPGSPPCSLLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLSLFEDTLDPT
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase;MYT1;myt1 kinase;PPP1R126;protein phosphatase 1,regulatory subunit 126.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Proximity ligation assay\|Western blot
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	PKMYT1
Gene Fullname	protein kinase, membrane associated tyrosine/threonine 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase preferentially phosphorylates and inactivates cell division cycle 2 protein (CDC2), and thus negatively regulates cell cycle G2/M transition. This kinase is associated with the membrane throughout the cell cycle. Its activity is highly regulated during the cell cycle. Protein kinases AKT1/PKB and PLK (Polo-like kinase) have been shown to phosphorylate and regulate the activity of this kinase. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Nucleotide accession_num	NM_004203
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_004194.3
Protein name	Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, mRNA\|membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase isoform 1 [Homo sapiens]
Clonality	Monoclonal
Immunogen	PKMYT1 (NP_004194.3, 400 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00435-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer