« Back
Home /
NMI Antibody

NMI Antibody

Item no.	OAAL00438
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Antibodies By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Culture Cytokines Immunohistochemistry Western Blot ELISA Primary Antibodies By Organ Bladder Cancer Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IHC, ELISA
Clone	9B8
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2b Kappa
Sequence	MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	N-myc-interactor.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Applications	Enzyme-linked immunosorbent assay\|Immunohistochemistry-Paraffin\|Western blot
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	NMI
Gene Fullname	N-myc and STAT interactor
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq
Nucleotide accession_num	BC001268
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH01268
Protein name	Homo sapiens N-myc (and STAT) interactor, mRNA (cDNA clone MGC:5050 IMAGE:3452659), complete cds\|N-myc (and STAT) interactor [Homo sapiens]
Clonality	Monoclonal
Immunogen	NMI (AAH01268, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00438-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer