Comparison

ARHGEF1 Antibody

Item no. OAAL00440
Manufacturer AVIVA Systems Biology
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, ELISA
Clone 2D2
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host Mouse
Isotype IgG2a Kappa
Sequence CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias 115 kDa guanine nucleotide exchange factor;115-kD protein;GEF1;IMD62;LBCL2;LSC;Lsc homolog;p115RhoGEF;P115-RHOGEF;Rho guanine nucleotide exchange factor (GEF) 1;rho guanine nucleotide exchange factor 1;SUB1.5.
Shipping Condition Cool pack
Available
Manufacturer - Type
Monoclonal Antibody
Manufacturer - Category
Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature
Wet Ice
Gene symbol
ARHGEF1
Gene Fullname
Rho guanine nucleotide exchange factor 1
Product format
Liquid
Reconstitution and storage
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target
Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq
Nucleotide accession_num
BC034013
Protein accession_num
https://www.ncbi.nlm.nih.gov/protein/AAH34013.2
Protein name
Homo sapiens Rho guanine nucleotide exchange factor (GEF) 1, mRNA (cDNA clone MGC:21456 IMAGE:3451036), complete cds|Rho guanine nucleotide exchange factor (GEF) 1 [Homo sapiens]
Clonality
Monoclonal
Immunogen
ARHGEF1 (AAH34013.2, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation
In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close