« Back
Home /
DCLK1 Antibody

DCLK1 Antibody

Item no.	OAAL00442
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Adhesion Molecules Antibodies Immunohistochemistry Western Blot ELISA Primary Antibodies Immunostaining Adhesion Molecule Markers Stem Cell Markers
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	7D10
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG1 Kappa
Sequence	QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CL1;CLICK1;DCAMKL1;DCDC3A;DCLK;doublecortin domain-containing protein 3A;doublecortin-like and CAM kinase-like 1;serine/threonine-protein kinase DCLK1.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	DCLK1
Gene Fullname	doublecortin like kinase 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	DCAMKL1 is a microtubule-associated protein that phosphorylates itself and myelin basic protein (MBP; MIM 159430). DCAMKL1 has microtubule polymerizing activity that is independent of its protein kinase activity (Lin et al., 2000 [PubMed 11124993]).[supplied by OMIM
Nucleotide accession_num	NM_004734
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_004725
Protein name	Homo sapiens doublecortin like kinase 1 (DCLK1), transcript variant 1, mRNA\|serine/threonine-protein kinase DCLK1 isoform 1 [Homo sapiens]
Clonality	Monoclonal
Immunogen	DCAMKL1 (NP_004725, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00442-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer