« Back
Home /
LIPG Antibody

LIPG Antibody

Item no.	OAAL00450
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Metabolism Cholesterol & Lipid Metabolism Antibodies By Cell Type Immunoprecipitation Western Blot ELISA Enzymes Fatty Acid Catabolism Primary Antibodies By Organ Thyroid Cancer Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IP, ELISA
Clone	4A9
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	SPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHE
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	EDL;EL;endothelial cell-derived lipase;endothelial lipase;lipase,endothelial;lipoprotein lipase H;phospholipase A1;PRO719.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	LIPG
Gene Fullname	lipase G, endothelial type
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. [provided by RefSeq
Nucleotide accession_num	BC060825
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH60825.1
Protein name	Homo sapiens lipase, endothelial, mRNA (cDNA clone MGC:71687 IMAGE:30338950), complete cds\|Lipase, endothelial [Homo sapiens]
Clonality	Monoclonal
Immunogen	LIPG (AAH60825.1, 21 a.a. ~ 500 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00450-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer