« Back
Home /
PICK1 Antibody

PICK1 Antibody

Item no.	OAAL00454
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Metabolism Diabetes Targets for Rodent Neurosciences Neural Signaling Antibodies By Cell Type Melanoma Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	3G5
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	KVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQ
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	PICK;PRKCA-binding protein;PRKCABP;protein interacting with C kinase 1;protein kinase C-alpha-binding protein.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	PICK1
Gene Fullname	protein interacting with PRKCA 1
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Nucleotide accession_num	NM_012407
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_036539
Protein name	Homo sapiens protein interacting with PRKCA 1 (PICK1), transcript variant 1, mRNA\|PRKCA-binding protein [Homo sapiens]
Clonality	Monoclonal
Immunogen	PRKCABP (NP_036539, 266 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00454-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer