« Back
Home /
C1D Antibody

C1D Antibody

Item no.	OAAL00520
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Neuroscience Neural Development Antibodies By Cell Type Blastoma Cell Biology Cytoskeleton Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining small GTPases Rho Subfamily
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IF, ELISA
Clone	4H5
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	C1D DNA-binding protein;C1D nuclear receptor co-repressor;hC1D;LRP1;nuclear DNA-binding protein;nuclear nucleic acid-binding protein C1D;Rrp47;small unique nuclear receptor corepressor;small unique nuclear receptor co-repressor;SUN-CoR;SUNCOR.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	C1D
Gene Fullname	C1D nuclear receptor corepressor
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several alternatively spliced transcript variants of this gene have been described, but the full length nature of some of these variants has not been determined. [provided by RefSeq
Nucleotide accession_num	BC016284
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH16284
Protein name	C1D nuclear receptor co-repressor [Homo sapiens]\|Homo sapiens C1D nuclear receptor co-repressor, mRNA (cDNA clone MGC:9308 IMAGE:3906517), complete cds
Clonality	Monoclonal
Immunogen	C1D (AAH16284, 1 a.a. ~ 141 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00520-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer