« Back
Home /
TFB1M Antibody

TFB1M Antibody

Item no.	OAAL00667
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Neuroscience Neural Transcription Factors Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	40000
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	MAASGKLSTCRLPPLPTIREIIKLLRLQAAKQLSQNFLLDLRLTDKIVRKAGNLTNAYVYEVGPGPGGITRSILNADVAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTFKVEKAFSESLKRPWEDDPPNVHIIGNLPFSVSTPLIIKWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMAQYLCNVRHIFTIPGQAFVPKPEVDVGVVHFTPLIQPKIEQPFKLVEKVVQNVFQF
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CGI75;CGI-75;dimethyladenosine transferase 1,mitochondrial;h-mtTFB1;homolog of yeast mitochondrial transcription factor B;hTFB1M;mitochondrial 12S rRNA dimethylase 1;mitochondrial dimethyladenosine transferase 1;mtTFB;mtTFB1;S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransferase 1.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	TFB1M
Gene Fullname	transcription factor B1, mitochondrial
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The transcription of genes from mitochondrial DNA requires a mitochondrial RNA polymerase (see POLRMT, MIM 601778) and a DNA-binding transcription factor (see TFAM, MIM 600438). Transcription factor B1 (TFB1M) is a part of this transcription complex.[supplied by OMIM
Nucleotide accession_num	BC017788
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/AAH17788
Protein name	Homo sapiens transcription factor B1, mitochondrial, mRNA (cDNA clone MGC:22289 IMAGE:4672440), complete cds\|Transcription factor B1, mitochondrial [Homo sapiens]
Clonality	Monoclonal
Immunogen	TFB1M (AAH17788, 1 a.a. ~ 346 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00667-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer