« Back
Home /
FNBP1L Antibody

FNBP1L Antibody

Item no.	OAAL00716
Manufacturer	AVIVA Systems Biology
Amount	100 ug
Category	Oncology Antibodies Cell Biology Cytoskeleton Immunohistochemistry Western Blot ELISA Primary Antibodies Microfilaments By Organ Breast Cancer Immunostaining small GTPases Rho Subfamily
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, ELISA
Clone	1000000
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host	Mouse
Isotype	IgG2a Kappa
Sequence	LNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERK
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	C1orf39;formin-binding protein 1-like;toca-1;TOCA1;transducer of Cdc42-dependent actin assembly 1;transducer of Cdc42-dependent actin assembly protein 1.
Shipping Condition	Cool pack
Available
Manufacturer - Type	Monoclonal Antibody
Manufacturer - Category	Root Catalog/Products/Monoclonal Antibodies, Root Catalog/Products/Primary Antibodies
Shipping Temperature	Wet Ice
Gene symbol	FNBP1L
Gene Fullname	formin binding protein 1 like
Product format	Liquid
Reconstitution and storage	Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Description of target	The protein encoded by this gene binds to both CDC42 and N-WASP. This protein promotes CDC42-induced actin polymerization by activating the N-WASP-WIP complex and, therefore, is involved in a pathway that links cell surface signals to the actin cytoskeleton. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Nucleotide accession_num	NM_017737
Protein accession_num	https://www.ncbi.nlm.nih.gov/protein/NP_060207.2
Protein name	formin-binding protein 1-like isoform 2 [Homo sapiens]\|Homo sapiens formin binding protein 1 like (FNBP1L), transcript variant 2, mRNA
Clonality	Monoclonal
Immunogen	FNBP1L (NP_060207.2, 175 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Formulation	In 1x PBS, pH 7.4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

OAAL00716-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/25/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer